All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (52)
- (1)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,879)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (190,046)
- (288,133)
- (1)
- (19)
- (798)
- (1)
- (12,221)
- (2)
- (130)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (13,022)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,043)
- (3,904)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,769)
- (18)
- (1)
- (1)
- (1)
- (5,550)
- (3)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,872)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,952)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,480)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,162)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,471)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,528)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,966)
- (24,937)
- (24,831)
- (24,994)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,058)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,472)
- (912)
- (835)
- (1,058)
- (1,061)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,923)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (735)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (76)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,848)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (542,719)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (565)
- (2,896)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,672)
- (68)
- (124)
- (2,111)
- (31,240)
- (221)
- (8)
- (23)
- (597,727)
- (16)
- (1)
- (800,301)
- (84,209)
- (3)
- (45,153)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (1)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,278)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,730)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,568)
- (2,675)
- (43,523)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,423)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,235)
- (153,811)
- (191)
- (53)
- (197,230)
- (502,588)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,562)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,659)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,340)
- (4)
- (2)
- (3)
- (26)
- (6,535)
- (1)
- (6)
- (814)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,280)
- (39)
- (6)
- (43,438)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,648)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,988)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,101)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,699)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,307)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,888)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,224)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,813)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,998)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,410)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,444)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,492)
- (545)
- (215)
- (25)
- (1,235)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,253)
- (532)
- (4)
- (10)
- (2)
- (338,714)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,935)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
Invitrogen™ CD73 Recombinant Rabbit Monoclonal Antibody (28H48L67)
Rabbit Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Western Blot |
| Form | Liquid |
| Gene Accession No. | P21589 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | CD73 |
| Gene Symbols | NT5E |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 2210401F01Rik; 5 nucleotidase, ecto; 5' nucleotidase, ecto; 5'-NT; 5'-nucleotidase; 5'-nucleotidase ecto; 5'-nucleotidase, ecto (CD73); AI447961; CALJA; CD73; E5NT; ecto-5'-nucleotidase; eN; eNT; NT; Nt5; Nt5e; NTE; Purine 5-Prime-Nucleotidase |
| Gene | NT5E |
| Product Type | Antibody |
| Gene ID (Entrez) | 4907 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Protein corresponding to human CD73 [aa31-aa540]. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 28H48L67 |
BCL6 Monoclonal Antibody (BCL-UP), APC, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | APC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P41182 |
| Concentration | 5 μL/Test |
| Antigen | BCL6 |
| Gene Symbols | BCL6 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | B cell CLL/lymphoma 6; B cell leukemia/lymphoma 6; B-cell CLL/lymphoma 6; B-cell CLL/lymphoma 6 (zinc finger protein 51); B-cell leukemia/lymphoma 5; B-cell leukemia/lymphoma 6; B-cell lymphoma 5 protein; B-cell lymphoma 5 protein (BCL5); B-cell lymphoma 6 protein; B-cell lymphoma 6 protein homolog; B-cell lymphoma 6 protein transcript; BCL5; BCL-5; Bcl6; Bcl-6; BCL6 transcription repressor; BCL6A; cys his2 zinc finger transcription factor; cys-his2 zinc finger transcription factor; LAZ3; LAZ-3 protein; Lymphoma Associated Zinc Finger Gene On Chromosome 3 (LAZ3); lymphoma-associated zinc finger gene on chromosome 3; protein LAZ-3; ZBTB27; zinc finger and BTB domain-containing protein 27; Zinc finger and BTB domain-containing protein 27 (ZBTB27); Zinc finger protein 51; Zinc Finger Protein 51 (ZNF51); zinc finger transcription factor BCL6S; ZNF51 |
| Gene | BCL6 |
| Product Type | Antibody |
| Gene ID (Entrez) | 604 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | BCL-UP |
Invitrogen™ MYBPC3 Recombinant Rabbit Monoclonal Antibody (19H1L3)
Rabbit Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | O70468, P56741, Q14896 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | MYBPC3 |
| Gene Symbols | MYBPC3 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | cardiac C-protein; cardiac MyBP-C; cardiac myosin binding protein C; CMD1MM; CMH4; C-protein, cardiac muscle isoform; DKFZp779E1762; FHC; LVNC10; MYBP-C; Mybpc3; myosin binding protein C, cardiac; myosin binding protein C3; myosin-binding protein C, cardiac-type; truncated cardiac myosin-binding protein C |
| Gene | MYBPC3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 17868, 295929, 4607 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Protein corresponding to human MYBPC3 [aa1-aa115]. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 19H1L3 |
Invitrogen™ H3K9me3 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Peptide Array,ChIP Assay,Immunohistochemistry (Paraffin),Immunomicroscopy,Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P68431, P68433, P84228, Q71DI3 |
| Isotype | IgG |
| Concentration | 0.2 mg/mL |
| Antigen | H3K9me3 |
| Gene Symbols | H3C1, H3C10, H3C12, H3C14, H3C15, H3C2, H3C7 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | B0035.7; CELE_T10C6.12; F07B7.10; F07B7.3; F08G2.2; F17E9.13; F35H10.1; F45F2.4; F54E12.5; F55G1.10; H02I12.7; H3; H3 histone; H3 histone family, member A; H3 histone family, member I; H3 histone family, member K; H3 histone family, member L; H3 histone family, member M; H3 histone, family 2; H3 histone, family 3A; H3 histone, family 3B; H3 histone, family 3B (H3.3B); H3 histone, family 3B.1; H3 histone, family 3C; H3 K9; H3.1-221; H3.1-291; H3.1-I; H3.2; H3.2-221; H3.2-614; H3.2-615; H3.2-616; H3.3A; H3.3B; H3.5; H3/A; H3/b; H3/d; H3/f; H3/i; H3/j; H3/k; H3/l; H3/M; H3/n; H3/o; H3-143; H3-291; H3-3A; H3-3B; h3-5; H3-53; H3-614; H3a; H3b; H3-B; H3c1; H3c10; H3C11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3f; H3-F; H3F1K; H3F2; H3F3; h3f3a; H3F3B; h3f3b.1; h3f3c; h3f3d; H3FA; H3FB; H3FC HIST1H3C; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; H3FM; H3FN; H3g; H3h; H3i; H3K9; H3Lys9me3; his-12; his-16; his-19; his-21; his-3; his-30; his-33; his-43; his-47; his-51; his-53; his-57; his-61; his-65; his-68; his-7; Hist1; Hist1h3a; HIST1H3B; Hist1h3c; Hist1h3d; HIST1H3E; Hist1h3f; HIST1H3G; Hist1h3h; HIST1H3I; HIST1H3J; HIST2H3A; Hist2h3b; HIST2H3C; Hist2h3c1; Hist2h3c2; Hist2h3c2-ps; Hist2h3ca1; Hist2h3ca2; HIST2H3D; histone 1, H3a; histone 1, H3b; histone 1, H3f; histone 1, H3h; histone 2, H3a; histone 2, H3c; histone 2, H3c2; histone 2, H3ca2; Histone 3; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3f; histone cluster 1, H3h; histone cluster 2, H3a; histone cluster 2, H3c; histone cluster 2, H3c2; histone cluster 2, H3c2, pseudogene; histone gene complex 1; Histone H2A; histone H3; histone H3.1; Histone H3.2; histone H3.3; Histone H3.3C; histone H3.5; Histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; Histone H3/i; Histone H3/j; Histone H3/k; histone H3/l; Histone H3/m; histone H3/o; Histone H3K9me3; histone variant H3.5; hypothetical protein LOC550262; K06C4.11; K06C4.3; M32461; methyl Histone 3; methyl Histone H3; PP781; T10C6.12; T23D8.6; Trimethyl H3; Tri-methyl H3; Trimethyl Histone H3; Tri-methyl Histone H3; Tri-Methyl-H3 K9; Tri-Methyl-H3 Lys9; Tri-Methyl-Histone H3 K9; Tri-Methyl-Histone H3 Lys9; wu:fa25h06; wu:fa96g06; wu:fb07a08; wu:fb36f01; zgc:110292; zgc:174300; zgc:56193; zgc:56418; zgc:64222; zgc:86731; ZK131.10; ZK131.6 |
| Gene | H3C15 |
| Product Type | Antibody |
| Gene ID (Entrez) | 126961, 260423, 291159, 310678, 319150, 319152, 333932, 360198, 679994, 8350, 8356, 8357, 8358, 8968, 97114 |
| Formulation | PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Carrier-protein conjugated synthetic peptide surrounding tri-methyl Lys9 of human Histone H3. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ DNMT3A Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ChIP Assay,Western Blot |
| Form | Liquid |
| Gene Accession No. | O88508, Q9Y6K1 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | DNMT3A |
| Gene Symbols | DNMT3A |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AU015806; DNA (cytosine-5-)-methyltransferase 3 alpha; DNA (cytosine-5)-methyltransferase 3A; DNA cytosine methyltransferase 3A2; DNA methyltransferase 3 alpha; DNA methyltransferase 3A; DNA methyltransferase HsaIIIA; DNA methyltransferase MmuIIIA; DNA MTase HsaIIIA; DNA MTase MmuIIIA; Dnmt3a; DNMT3A2; M.HsaIIIA; MmuIIIA; TBRS; W91664 |
| Gene | DNMT3A |
| Product Type | Antibody |
| Gene ID (Entrez) | 13435, 1788 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | Synthetic peptide corresponding to residues D(86) L L P N G D L E K R S E P Q(100) C of human Dnmt3a. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ BOB-1 Recombinant Rabbit Monoclonal Antibody (2H4L5)
Rabbit Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ChIP Assay,Western Blot |
| Form | Liquid |
| Gene Accession No. | Q16633 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | BOB-1 |
| Gene Symbols | POU2AF1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | B-cell-specific coactivator OBF-1; BOB.1; Bob1; BOB-1; OBF.1; OBF1; Obf-1; OCAB; OCA-B; OCT-binding factor 1; POU class 2 associating factor 1; POU domain class 2-associating factor 1; POU domain, class 2, associating factor 1; Pou2af1 |
| Gene | POU2AF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 5450 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Protein corresponding to human BOB-1 [aa1-aa256]. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 2H4L5 |
Invitrogen™ RARA Monoclonal Antibody (Ralpha10)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunocytochemistry,Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P10276, P11416 |
| Isotype | IgG1 |
| Concentration | Conc. Not Determined |
| Antigen | RARA |
| Gene Symbols | RARA |
| Regulatory Status | RUO |
| Gene Alias | Nr1b1; nuclear receptor subfamily 1 group B member 1; nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form; RAR; RAR Alpha; RAR alpha 1; RARA; RAR-alpha; RARalpha1; retinoic acid; retinoic acid nuclear receptor alpha variant 1; retinoic acid nuclear receptor alpha variant 2; retinoic acid receptor; retinoic acid receptor alpha; retinoic acid receptor, alpha; retinoic acid receptor, alpha polypeptide; RRA |
| Gene | RARA |
| Product Type | Antibody |
| Gene ID (Entrez) | 19401, 24705, 5914 |
| Formulation | Ascites with 0.05% sodium azide |
| Immunogen | Synthetic peptide corresponding to residues C(444) S P S L S P S S H R S S P A T Q S P(462) of mouse RAR alpha. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | Ralpha10 |
Invitrogen™ GSTM5 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P46439, P48774, Q9Z1B2 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | GSTM5 |
| Gene Symbols | GSTM5 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | fibrous sheath component 2; Fsc2; glutathione S-alkyltransferase M5; glutathione S-aralkyltransferase M5; glutathione S-aryltransferase M5; glutathione S-transferase M5; glutathione S-transferase Mu 5; glutathione S-transferase, mu 5; glutathione-S-transferase, mu 5; GST class-mu 5; Gstm3; GSTM5; GSTM5-5; GTM5; S-(hydroxyalkyl)glutathione lyase M5 |
| Gene | GSTM5 |
| Product Type | Antibody |
| Gene ID (Entrez) | 14866, 2949, 64352 |
| Formulation | 0.1M tris glycine with 10% glycerol and 0.01% thimerosal; pH 7 |
| Immunogen | Full length human GSTM5 Recombinant protein. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ MGA Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Lyophilized |
| Gene Accession No. | Q8IWI9 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | MGA |
| Gene Symbols | MGA |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AV312082; C130042M01Rik; C80739; D030062C11Rik; FLJ12634; KIAA0518; Kiaa4252; LOW QUALITY PROTEIN: MAX gene-associated protein; Mad5; maltase-glucoamylase (alpha-glucosidase); Max dimerization protein 5; MAX dimerization protein MGA; MAX gene associated; MAX gene-associated protein; MAX protein-associated protein-like protein; MAX-associated protein; MAX-interacting protein; MGA; MGA, MAX dimerization protein; MGA-like protein; MXD5; RGD1561597 |
| Gene | MGA |
| Product Type | Antibody |
| Gene ID (Entrez) | 23269 |
| Formulation | PBS with 4mg trehalose and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MGA (2376-2415aa QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Lamin A/C Monoclonal Antibody (4A7), eBioscience™, Invitrogen™
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Human,Mouse,Rabbit,Hamster |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P02545, P48678 |
| Concentration | 0.5 mg/mL |
| Antigen | Lamin A/C |
| Gene Symbols | LMNA |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 70 kDa lamin; cb948; CDCD1; CDDC; CMD1A; CMT2B1; Dhe; EMD2; FPL; FPLD; FPLD2; HGPS; I79_009616; IDC; lamin; lamin A; lamin A/C; lamin A/C L homeolog; lamin A/C-like 1; Lamin A+C mutant; Lamin AC; lamin a-c; lamin C; lamin C2; lamin-A; Lamin-A/C; LDP1; LFP; LGMD1B; LMN1; lmna; LMNA protein; lmna.L; lmna-A; LMNC; LMNL1; mutant 453W; Mutant lamin A/C; nuclear intermediate filament protein; nuclear lamin A; prelamin-A/C; PRO1; progerin mutant; Renal carcinoma antigen NY-REN-32; RP11-54H19.1; unnamed protein product; wu:fk66d12; XELAEV_18040808mg |
| Gene | LMNA |
| Product Type | Antibody |
| Gene ID (Entrez) | 100343574, 100757316, 16905, 4000 |
| Formulation | PBS with 0.09% Sodium Azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 4A7 |
Invitrogen™ GP6 Monoclonal Antibody (HY101), eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Western Blot |
| Form | Liquid |
| Gene Accession No. | Q9HCN6 |
| Isotype | IgG1 κ |
| Concentration | 0.5 mg/mL |
| Antigen | GP6 |
| Gene Symbols | GP6 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 9830166G18Rik; BDPLT11; Glycoprotein 5; glycoprotein 6; glycoprotein 6 (platelet); glycoprotein VI (platelet); glycoprotein VI platelet; Gm469; GP6; GPIV; GPVI; platelet collagen receptor; platelet glycoprotein VI |
| Gene | GP6 |
| Product Type | Antibody |
| Gene ID (Entrez) | 51206 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HY101 |
Invitrogen™ FOXM1 Recombinant Rabbit Monoclonal Antibody (1H24L2)
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ChIP Assay,Flow Cytometry,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q08050 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | FOXM1 |
| Gene Symbols | FOXM1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AA408308; AW554517; BB238854; cell growth-inhibiting gene 27 protein; FGCP; FKH L16; Fkh16; FKHL 16; FKHL16; folate hydrolase (prostate-specific membrane antigen) 1; Folate hydrolase 1; FOLH; FOLH1; Folylpoly-gamma-glutamate carboxypeptidase; forkhead box M1; forkhead box protein M1; forkhead homolog 16; Forkhead like 16; Forkhead, drosophila, homolog-like 16; forkhead-related protein FKHL16; FOXM 1; FOXM 1c; FOXM1; FOXM1B; GCP2; GCPII; GIG27; glutamate carboxylase II; glutamate carboxypeptidase 2; Glutamate carboxypeptidase II; hepatocyte nuclear factor 3 forkhead homolog 11; HFH 11; HFH11; HFH-11; HFH-11B; HNF 3; HNF3; HNF-3; HNF-3/fork-head homolog 11; INS 1; INS1; INS-1; INS-1 winged helix; Membrane glutamate carboxypeptidase; mGCP; M-phase phosphoprotein 2; MPHOSPH 2; MPHOSPH2; MPM 2; Mpm2; MPM-2 reactive phosphoprotein 2; MPP 2; MPP2; MPP-2; NAALAD1; NAALAdase; NAALADase I; N-acetylated alpha-linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; PIG 29; PIG29; prostate specific membrane antigen variant F; Prostate-specific membrane antigen; PSM; PSMA; Pteroylpoly-gamma-glutamate carboxypeptidase; TGT3; transcription factor Trident; TRIDENT; WIN; Winged-helix factor from INS-1 cells; winged-helix transcription factor Trident |
| Gene | FOXM1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 2305 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Protein corresponding to human FOXM1 (aa1-aa250). |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 1H24L2 |
Invitrogen™ Kinesin 5C Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | O60282 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | Kinesin 5C |
| Gene Symbols | KIF5C |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | CDCBM2; Khc; KIAA0531; KIF5C; kinesin family member 5C; kinesin heavy chain isoform 5C; kinesin heavy chain member 5C; kinesin heavy chain neuron-specific 2; KINN; NKHC; NKHC2; NKHC-2 |
| Gene | KIF5C |
| Product Type | Antibody |
| Gene ID (Entrez) | 3800 |
| Formulation | PBS with 1 mg/mL BSA and 0.05% sodium azide |
| Immunogen | Synthetic Peptide: C A(938) V H A I R G G G G S S S N S T H Y Q K(957). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
IL-23 p19 Monoclonal Antibody (G23-8), Functional Grade, eBioscience™, Invitrogen™
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Functional Grade |
| Applications | ELISA,Functional Assay,Neutralization,Western Blot |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | Q9EQ14 |
| Concentration | 1 mg/mL |
| Antigen | IL-23 p19 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene | IL23A |
| Product Type | Antibody |
| Gene ID (Entrez) | 83430 |
| Formulation | PBS with no preservative; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | G23-8 |
Invitrogen™ beta Actin Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Chicken Polyclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Chicken |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P60709, P60710, P60711 |
| Isotype | IgY |
| Concentration | 1 mg/mL |
| Antigen | beta Actin |
| Gene Symbols | ACTB |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 0610041G09Rik; AA959943; AAT6; ACT; Act4; Act-4; ACT-5; ACTA; acta1; acta1b; ACTA2; Acta-2; ACTA3; actb; actb.L; actb1; actba; ACTC; actc1; Actc-1; actc1b; ACTE; Actg; ACTG1; Actg2; ACTGE; actin; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 1, skeletal muscle b; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin alpha cardiac muscle 1b; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin, alpha 1, skeletal muscle; actin, alpha 1b, skeletal muscle; actin, alpha 2, smooth muscle, aorta; Actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; actin, alpha cardiac muscle 1b; actin, alpha skeletal muscle; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta 1; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; actin, gamma 1; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha actin 1; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-smooth muscle actin; ASD5; ASMA; a-SMA; Bact; Bact; actin; B-actin; bactin1; bactin1 protein; bactzf; B-ACTZF; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin-1; BRWS1; BRWS2; cardiac muscle alpha actin 1; cardiofunk; cell growth-inhibiting gene 46 protein; Cfk; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoplasmic 1; cytoplasmic beta-actin; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; E430023M04Rik; E51; epididymis luminal protein 176; fa27h01; fb83f06; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hm:zeh0631; I79_002310; I79_013242; I79_019066; LVNC4; MPFD; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; PS1TP5-binding protein 1; PS1TP5BP1; SHPM; similar to beta actin; skeletal alpha actin; skeletal alpha1 actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; vascular smooth muscle alpha-actin; VSCM; wu:fa27h01; wu:fb63d03; wu:fb83f06; wu:fd18f05; XELAEV_18045052mg; zeh0631 |
| Gene | ACTB |
| Product Type | Antibody |
| Gene ID (Entrez) | 11461, 60, 81822 |
| Formulation | PBS with 0.02% sodium azide |
| Immunogen | A 16 amino acid synthetic peptide from near the amino terminus of human beta-actin. The immunogen is located within amino acids 90-140 of Beta-actin. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |